Datasheet ICL3225E, ICL3227E, ICL3245E 15kV ESD Protected, +3V to +5.5V, 1A, 1Mbps, RS-232 Transceivers with Enhanced Automatic Powerdown The ICL3225E, ICL3227E, and ICL3245E devices are 3.0V to 5.5V powered RS-232 transmitters/receivers that meet ElA/TIA-232 and V.28/V.24 specifications, even at VCC = 3.0V. They provide 15kV ESD protection (IEC61000-4-2 Air Gap and Human Body Model) on transmitter outputs and receiver inputs (RS-232 pins). Targeted applications are PDAs, Palmtops, and notebook and laptop computers where the low operational power consumption and even lower standby power consumption are critical. Efficient on-chip charge pumps coupled with manual and enhanced automatic powerdown functions, reduce the standby supply current to a 1A trickle. Small footprint packaging and the use of small, low value capacitors ensure board space savings. Data rates greater than 1Mbps are ensured at worst case load conditions. This family is fully compatible with 3.3V only systems, mixed 3.3V and 5.0V systems, and 5.0V only systems. The ICL3245E is a 3-driver, 5-receiver device that provides a complete serial port suitable for laptop or notebook computers. It also includes a noninverting always-active receiver for "wake-up" capability. Features * Pb-free (RoHS compliant) * ESD protection for RS-232 I/O pins to 15kV (IEC61000) * Manual and enhanced automatic powerdown features * Drop in replacements for MAX3225E, MAX3227E, MAX3245E * RS-232 compatible with VCC = 2.7V * Meets EIA/TIA-232 and V.28/V.24 specifications at 3V * Latch-up free * On-chip voltage converters require only four external 0.1F capacitors * Ensured mouse driveability (ICL3245E) * "Ready to Transmit" indicator output (ICL3225E/ICL3227E) * Receiver hysteresis for improved noise immunity * Ensured minimum data rate: 1Mbps The ICL3225E, ICL3227E, and ICL3245E feature an enhanced automatic powerdown function that powers down the on-chip power supply and driver circuits. Powerdown occurs when all receiver and transmitter inputs detect no signal transitions for a period of 30s. These devices power back up automatically whenever they sense a transition on any transmitter or receiver input. * Low skew at transmitter/receiver input trip points: 10ns Table 1 summarizes the features of the device represented by this datasheet and AN9863 summarizes the features of each device in the ICL32xxE 3V family. * Any system requiring RS-232 communication ports Related Literature For a full list of related documents, visit our website: * ICL3225E, ICL3227E, and ICL3245E device pages FN4900 Rev.13.00 May.2.19 * Ensured minimum slew rate: 24V/s * Wide power supply range: single +3V to +5.5V * Low supply current in powerdown state: 1A Applications Battery powered, hand-held, and portable equipment Laptop computers, notebooks, palmtops Modems, printers, and other peripherals Digital cameras Cellular/mobile phones Page 1 of 28 ICL3225E, ICL3227E, ICL3245E Contents 1. Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 1.1 1.2 1.3 1.4 2. Typical Operating Circuits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ordering Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Pin Configurations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Pin Descriptions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 5 5 6 Specifications. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 2.1 2.2 2.3 2.4 Absolute Maximum Ratings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermal Information. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Recommended Operating Conditions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Electrical Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 7 7 8 3. Typical Performance Curves. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 4. Application Information. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 4.1 4.1.1 4.2 4.3 4.4 4.4.1 4.4.2 4.4.3 4.4.4 4.4.5 4.5 4.6 4.7 4.8 4.9 4.10 4.11 4.12 5. Charge Pump. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Charge Pump Abs Max Ratings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Transmitters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Receivers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Powerdown Functionality . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Software Controlled (Manual) Powerdown . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . INVALID Output . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Enhanced Automatic Powerdown . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Emulating Standard Automatic Powerdown. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Hybrid Automatic Powerdown Options . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . READY Output (ICL3225E and ICL3227E Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Capacitor Selection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Power Supply Decoupling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Operation Down to 2.7V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Transmitter Outputs when Exiting Powerdown . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Mouse Driveability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . High Data Rates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Interconnection with 3V and 5V Logic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 12 13 14 15 16 16 17 18 19 19 19 19 19 19 20 20 21 15kV ESD Protection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 5.1 5.2 5.3 5.4 Human Body Model (HBM) Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . IEC61000-4-2 Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Air-Gap Discharge Test Method. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Contact Discharge Test Method. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 22 22 22 6. Die Characteristics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 7. Revision History. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 8. Package Outline Drawings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 FN4900 Rev.13.00 May.2.19 Page 2 of 28 ICL3225E, ICL3227E, ICL3245E 1. 1.1 1. Overview Overview Typical Operating Circuits +3.3V + C1 0.1F C2 0.1F 5 + 6 T1IN T2IN TTL/CMOS Logic Levels 0.1F 2 + 4 R1OUT C1+ 19 VCC V+ C1C2+ V- 7 C2T1 13 17 T2 12 8 15 16 5k R1 R2OUT 10 9 5k R2 1 14 3 READY FORCEOFF INVALID FORCEON 20 11 + C3 0.1F C4 0.1F + T1OUT T2OUT R1IN RS-232 Levels R2IN VCC To Power Control Logic GND 18 Figure 1. ICL3225E +3.3V + 0.1F C1 0.1F C2 0.1F T1IN TTL/CMOS Logic Levels R1OUT 2 + C1+ 4 C15 + C2+ 6 C2- 15 VCC V+ V- 7 T1 11 13 9 8 READY FORCEOFF 12 + C3 0.1F C4 + 0.1F T1OUT R1IN RS-232 Levels 5k R1 1 3 FORCEON GND INVALID 16 10 VCC To Power Control Logic 14 Figure 2. ICL3227E FN4900 Rev.13.00 May.2.19 Page 3 of 28 ICL3225E, ICL3227E, ICL3245E +3.3V + 1. Overview 0.1F C1 0.1F C2 0.1F T1IN T2IN 28 + 26 C1+ VCC 24 C11 C2+ + 2 C2- 27 V+ V- T1 14 9 T2 13 10 T3 12 3 + C3 0.1F C4 0.1F + T1OUT T2OUT RS-232 Levels 11 T3IN T3OUT 20 R2OUTB TTL/CMOS Logic Levels 19 4 R1OUT R1IN R1 R2OUT 5k 18 5 R2 17 6 R3OUT R3IN R3 R4OUT 5k 16 7 R4 R5OUT To Power Control Logic 22 21 RS-232 Levels R4IN 5k 15 23 VCC R2IN 5k 8 5k R5 R5IN FORCEON FORCEOFF INVALID GND 25 Figure 3. ICL3245E FN4900 Rev.13.00 May.2.19 Page 4 of 28 ICL3225E, ICL3227E, ICL3245E 1.2 1. Overview Ordering Information Part Number (Notes 2, 3) Part Marking Temp Range (C) Tape and Reel (Units) (Note 1) Package (RoHS Compliant) Pkg. Dwg. # ICL3225ECAZ ICL3225ECAZ 0 to +70 - 20 Ld SSOP M20.209 ICL3225ECAZ-T ICL3225ECAZ 0 to +70 1k 20 Ld SSOP M20.209 ICL3225EIAZ ICL3225EIAZ -40 to +85 - 20 Ld SSOP M20.209 ICL3225EIAZ-T ICL3225EIAZ -40 to +85 1k 20 Ld SSOP M20.209 ICL3227ECAZA 3227ECAZ 0 to +70 - 16 Ld SSOP M16.209 ICL3227ECAZA-T 3227ECAZ 0 to +70 1k 16 Ld SSOP M16.209 ICL3227EIAZA 3227EIAZ -40 to +85 - 16 Ld SSOP M16.209 ICL3227EIAZA-T 3227EIAZ -40 to +85 1k 16 Ld SSOP M16.209 ICL3245ECAZ ICL3245ECAZ 0 to +70 - 28 Ld SSOP M28.209 ICL3245ECAZ-T ICL3245ECAZ 0 to +70 1k 28 Ld SSOP M28.209 ICL3245EIAZ ICL3245EIAZ -40 to +85 - 28 Ld SSOP M28.209 ICL3245EIAZ-T ICL3245EIAZ -40 to +85 1k 28 Ld SSOP M28.209 Notes: 1. See TB347 for details about reel specifications. 2. These Pb-free plastic packaged products employ special Pb-free material sets, molding compounds/die attach materials, and 100% matte tin plate plus anneal (e3 termination finish, which is RoHS compliant and compatible with both SnPb and Pb-free soldering operations). Pb-free products are MSL classified at Pb-free peak reflow temperatures that meet or exceed the Pb-free requirements of IPC/JEDEC JSTD-020. 3. For Moisture Sensitivity Level (MSL), see the ICL3225E, ICL3227E, and ICL3245E device pages. For more information about MSL, see TB363. Table 1. Summary of Features Data Rate (kbps) Rx. Enable Function? Ready Output? Manual Powerdown? Enhanced Automatic Powerdown Function? Part Number Number of Tx. Number of Rx. Number of Monitor Rx. (ROUTB) ICL3225E 2 2 0 1000 No Yes Yes Yes ICL3227E 1 1 0 1000 No Yes Yes Yes ICL3245E 3 5 1 1000 No No Yes Yes 1.3 Pin Configurations ICL3225E (SSOP) Top View READY 1 20 FORCEOFF ICL3227E (SSOP) Top View READY 1 16 FORCEOFF 19 VCC C1+ 2 18 GND V+ C1- 4 17 T1OUT C1- 4 13 T1OUT C2+ 5 16 R1IN C2+ 5 12 FORCEON C2- 6 15 R1OUT C2- 6 11 T1IN C1+ 2 V+ 3 V- 7 14 FORCEON T2OUT 8 13 T1IN R2IN 9 12 T2IN R2OUT 10 FN4900 Rev.13.00 May.2.19 3 V- 7 R1IN 8 15 VCC 14 GND 10 INVALID 9 R1OUT 11 INVALID Page 5 of 28 ICL3225E, ICL3227E, ICL3245E 1. Overview ICL3245E (SSOP) Top View C2+ 1 28 C1+ C2- 2 27 V+ V- 1.4 3 26 VCC R1IN 4 25 GND R2IN 5 24 C1- R3IN 6 23 FORCEON R4IN 7 22 FORCEOFF R5IN 8 21 INVALID T1OUT 9 20 R2OUTB T2OUT 10 19 R1OUT T3OUT 11 18 R2OUT T3IN 12 17 R3OUT T2IN 13 16 R4OUT T1IN 14 15 R5OUT Pin Descriptions Pin Function VCC System power supply input (3.0V to 5.5V). V+ Internally generated positive transmitter supply (+5.5V). V- Internally generated negative transmitter supply (-5.5V). GND Ground connection. C1+ External capacitor (voltage doubler) is connected to this lead. C1- External capacitor (voltage doubler) is connected to this lead. C2+ External capacitor (voltage inverter) is connected to this lead. C2- External capacitor (voltage inverter) is connected to this lead. TxIN TTL/CMOS compatible transmitter Inputs. TxOUT RxIN RxOUT 15kV ESD protected, RS-232 level (nominally 5.5V) transmitter outputs. 15kV ESD protected, RS-232 compatible receiver inputs. TTL/CMOS level receiver outputs. R2OUTB TTL/CMOS level, noninverting, always enabled receiver outputs. INVALID Active low output that indicates if no valid RS-232 levels are present on any receiver input. READY Active high output that indicates when the ICL32xxE is ready to transmit (V- -4V). FORCEOFF Active low to shut down transmitters and on-chip power supply, which overrides any automatic circuitry and FORCEON (see Table 5 on page 15). FORCEON Active high input to override automatic powerdown circuitry and keeps transmitters active. (FORCEOFF must be high). FN4900 Rev.13.00 May.2.19 Page 6 of 28 ICL3225E, ICL3227E, ICL3245E 2. 2. Specifications Specifications 2.1 Absolute Maximum Ratings Parameter Minimum Maximum Unit VCC to GND -0.3 6 V V+ to GND -0.3 7 V V- to GND +0.3 -7 V 14 V 6 V 25 V 13.2 V VCC +0.3 V V+ to VInput Voltages TIN, FORCEOFF, FORCEON -0.3 RIN Output Voltages TOUT ROUT, INVALID, READY -0.3 Short-Circuit Duration TOUT Continuous ESD Rating (See "ESD Performance" on page 9) CAUTION: Do not operate at or near the maximum ratings listed for extended periods of time. Exposure to such conditions can adversely impact product reliability and result in failures not covered by warranty. 2.2 Thermal Information Thermal Resistance (Typical, Note 4) JA (C/W) 16 Ld SSOP Package 145 20 Ld SSOP Package 135 28 Ld SSOP Package 100 Notes: 4. JA is measured with the component mounted on a low-effective thermal conductivity test board in free air. See TB379 for details. Parameter Minimum Maximum Junction Temperature (Plastic Package) Maximum Storage Temperature Range -65 Pb-Free Reflow Profile 2.3 Maximum Unit +150 C +150 C see TB493 Recommended Operating Conditions Parameter Minimum Maximum Unit ICL32xxEC 0 +70 C ICL32xxEI -40 +85 C Temperature Range FN4900 Rev.13.00 May.2.19 Page 7 of 28 ICL3225E, ICL3227E, ICL3245E 2.4 2. Specifications Electrical Specifications Test conditions: VCC = 3V to 5.5V, C1 - C4 = 0.1F; unless otherwise specified. Typicals are at TA = +25C Parameter Test Conditions Temp (C) Min Typ Max Unit DC Characteristics Supply Current, Automatic Powerdown All RIN open, FORCEON = GND, FORCEOFF = VCC +25 - 1.0 10 A Supply Current, Powerdown FORCEOFF = GND +25 - 1.0 10 A Supply Current, Automatic Powerdown Disabled All outputs unloaded, FORCEON = FORCEOFF = VCC +25 - 0.3 1.0 mA Logic and Transmitter Inputs and Receiver Outputs Input Logic Threshold Low TIN, FORCEON, FORCEOFF Full - - 0.8 V Input Logic Threshold High TIN, FORCEON, FORCEOFF VCC = 3.3V Full 2.0 - - V VCC = 5.0V Full 2.4 - - V Input Leakage Current TIN, FORCEON, FORCEOFF Full - 0.01 1.00 A Output Leakage Current FORCEOFF = GND, ICL3245E only Full - 0.05 10 A Output Voltage Low IOUT = 1.6mA Full - - 0.4 V Output Voltage High IOUT = -1.0mA Full - V VCC - 0.6 VCC - 0.1 Receiver Inputs Input Voltage Range Full -25 - 25 V VCC = 3.3V +25 0.6 1.2 - V VCC = 5.0V +25 0.8 1.5 - V VCC = 3.3V +25 - 1.5 2.4 V VCC = 5.0V +25 - 1.8 2.4 V Input Hysteresis +25 - 0.5 - V Input Resistance +25 3 5 7 k Input Threshold Low Input Threshold High Transmitter Outputs Output Voltage Swing All transmitter outputs loaded with 3k to Ground Full 5.0 5.4 - V Output Resistance VCC = V+ = V- = 0V, transmitter output = 2V Full 300 10M - Full - 35 60 mA VOUT = 12V, VCC = 0V or 3V to 5.5V, automatic powerdown or FORCEOFF = GND Full - - 25 A T1IN = T2IN = GND, T3IN = VCC, T3OUT loaded with 3k to GND, T1OUT and T2OUT loaded with 2.5mA each Full 5 - - V Output Short-Circuit Current Output Leakage Current Mouse Driveability Transmitter Output Voltage (See Figure 20 on page 20) Enhanced Automatic Powerdown (FORCEON = GND, FORCEOFF = VCC) Receiver Input Thresholds to INVALID High See Figure 15 on page 17 Full -2.7 - 2.7 V Receiver Input Thresholds to INVALID Low See Figure 15 on page 17 Full -0.3 - 0.3 V INVALID, READY Output Voltage Low IOUT = 1.6mA Full - - 0.4 V INVALID, READY Output Voltage High IOUT = -1.0mA Full VCC - 0.6 - - V +25 - 1 - s Receiver Positive or Negative Threshold to INVALID High Delay (tINVH) FN4900 Rev.13.00 May.2.19 Page 8 of 28 ICL3225E, ICL3227E, ICL3245E 2. Specifications Test conditions: VCC = 3V to 5.5V, C1 - C4 = 0.1F; unless otherwise specified. Typicals are at TA = +25C (Continued) Parameter Test Conditions Receiver Positive or Negative Threshold to INVALID Low Delay (tINVL) Temp (C) Min Typ Max Unit +25 - 30 - s Receiver or Transmitter Edge to Transmitters Enabled Delay (tWU) (Note 5) 25 - 100 - s Receiver or Transmitter Edge to Transmitters Disabled Delay (tAUTOPWDN) (Note 5) Full 15 30 60 sec CL = 1000pF Full 250 - - kbps VCC = 3V to 4.5V, CL = 250pF Full 1000 - - kbps VCC = 4.5V to 5.5V, CL = 1000pF Full 1000 - - kbps tPHL +25 - 0.15 - s tPLH +25 - 0.15 - s Timing Characteristics Maximum Data Rate Receiver Propagation Delay RL = 3k, one transmitter switching Receiver input to receiver output, CL = 150pF Receiver Output Enable Time Normal operation (ICL3245E only) +25 - 200 - ns Receiver Output Disable Time Normal operation (ICL3245E only) +25 - 200 - ns Transmitter Skew tPHL - tPLH (Note 6) +25 - 25 - ns Receiver Skew tPHL - tPLH (Note 6) +25 - 50 - ns Transition Region Slew Rate VCC = 3.3V, RL = 3k to 7k, measured from 3V to -3V or -3V to 3V, CL = 150pF to 1000pF +25 24 - 150 V/s Human body model +25 - 15 - kV IEC61000-4-2 contact discharge +25 - 8 - kV IEC61000-4-2 air gap discharge +25 - 15 - kV ICL3245E Human body model (HBM) +25 - 2 - kV Charged Device Model (CDM) +25 - 1.5 - kV Human body model (HBM) +25 - 4 - kV Charged Device Model (CDM) +25 - 2 - kV ESD Performance RS-232 Pins (TOUT, RIN) All Other Pins ICL3225E, ICL3227E Notes: 5. An "edge" is defined as a transition through the transmitter or receiver input thresholds. 6. Skews are measured at the receiver input switching points (1.4V). FN4900 Rev.13.00 May.2.19 Page 9 of 28 ICL3225E, ICL3227E, ICL3245E 3. 3. Typical Performance Curves Typical Performance Curves VCC = 3.3V, TA = +25C 6 110 4 90 +SLEW 2 Slew Rate (V/s) Transmitter Output Voltage (V) VOUT+ 1 Transmitter at 1Mbps Other Transmitters at 30kbps 0 -2 VOUT- 70 50 -SLEW 30 -4 10 -6 0 1000 2000 3000 4000 0 5000 0 1000 2000 3000 4000 5000 Load Capacitance (pF) Load Capacitance (pF) Figure 4. Transmitter Output Voltage vs Load Capacitance Figure 5. Slew Rate vs Load Capacitance 90 90 ICL3225E ICL3227E 1Mbps 80 80 1Mbps 70 Supply Current (mA) Supply Current (mA) 70 60 50 40 250kbps 30 60 50 250kbps 40 120kbps 30 120kbps 20 20 10 0 1000 2000 3000 4000 5000 Load Capacitance (pF) Figure 6. Supply Current vs Load Capacitance When Transmitting Data FN4900 Rev.13.00 May.2.19 10 0 1000 2000 3000 4000 5000 Load Capacitance (pF) Figure 7. Supply Current vs Load Capacitance When Transmitting Data Page 10 of 28 ICL3225E, ICL3227E, ICL3245E 3. Typical Performance Curves VCC = 3.3V, TA = +25C (Continued) 90 3.5 80 3.0 Supply Current (mA) 70 Supply Current (mA) No Load All Outputs Static 1Mbps ICL3245E 60 50 250kbps 40 30 2.5 2.0 1.5 1.0 120kbps 0.5 20 10 0 1000 2000 3000 4000 5000 Load Capacitance (pF) Figure 8. Supply Current vs Load Capacitance When Transmitting Data FN4900 Rev.13.00 May.2.19 0 2.5 3.0 3.5 4.0 4.5 5.0 5.5 6.0 Supply Voltage (V) Figure 9. Supply Current vs Supply Voltage Page 11 of 28 ICL3225E, ICL3227E, ICL3245E 4. 4. Application Information Application Information The ICL3225E, ICL3227E, and ICL3245E (ISL32xxE) operate from a single +3V to +5.5V supply, ensure a 1Mbps minimum data rate, require only four small external 0.1F capacitors, feature low power consumption, and meet all ElA RS-232C and V.28 specifications. 4.1 Charge Pump The ICL32xxE use regulated on-chip dual charge pumps as voltage doublers, and voltage inverters to generate 5.5V transmitter supplies from a VCC supply as low as 3.0V, which allows these devices to maintain RS-232 compliant output levels over the 10% tolerance range of 3.3V powered systems. The efficient on-chip power supplies require only four small, external 0.1F capacitors for the voltage doubler and inverter functions at VCC = 3.3V. See the Capacitor Selection, and Table 6 on page 19 for capacitor recommendations for other operating conditions. The charge pumps operate discontinuously (turning off when the V+ and V- supplies are pumped up to the nominal values), resulting in significant power savings. 4.1.1 Charge Pump Abs Max Ratings These 3V to 5V RS-232 transceivers have been fully characterized for 3.0V to 3.6V operation and for critical points at 4.5V to 5.5V operation. Furthermore, load conditions were favorable using static logic states only. The specified maximum values for V+ and V- are +7V and -7V, respectively. These limits apply for VCC values set to 3.0V and 3.6V (see Table 2). For VCC values set to 4.5V and 5.5V, the maximum values for V+ and V- can approach +9V and -7V, respectively (Table 3 on page 13). The breakdown characteristics for V+ and V- were measured with 13V. Table 2. V+ and V- Values for VCC = 3.0V to 3.6V V+ (V) V- (V) C1 (F) C2, C3, C4 (F) Load T1IN (Logic State) 0.1 0.1 Open H 5.80 6.56 -5.60 -5.88 L 5.80 6.56 -5.60 -5.88 2.4kbps 5.80 6.56 -5.60 -5.88 H 5.88 6.60 -5.56 -5.92 L 5.76 6.36 -5.56 -5.76 2.4kbps 6.00 6.64 -5.64 -5.96 H 5.68 6.00 -5.60 -5.60 L 5.68 6.00 -5.60 -5.60 2.4kbps 5.68 6.00 -5.60 -5.60 H 5.76 6.08 -5.64 -5.64 L 5.68 6.04 -5.60 -5.60 2.4kbps 5.84 6.16 -5.64 -5.72 H 5.88 6.24 -5.60 -5.60 L 5.88 6.28 -5.60 -5.64 2.4kbps 5.80 6.20 -5.60 -5.60 H 5.88 6.44 -5.64 -5.72 L 5.88 6.04 -5.64 -5.64 2.4kbps 5.92 6.40 -5.64 -5.64 3k // 1000pF 0.047 0.33 Open 3k // 1000pF 1 1 Open 3k // 1000pF FN4900 Rev.13.00 May.2.19 VCC = 3.0V VCC = 3.6V VCC = 3.0V VCC = 3.6V Page 12 of 28 ICL3225E, ICL3227E, ICL3245E Table 3. 4. Application Information V+ and V- Values for VCC = 4.5V to 5.5V V+ (V) V- (V) C1 (F) C2, C3, C4 (F) Load T1IN (Logic State) 0.1 0.1 Open H 7.44 8.48 -6.16 -6.40 L 7.44 8.48 -6.16 -6.44 2.4kbps 7.44 8.48 -6.17 -6.44 H 7.76 8.88 -6.36 -6.72 L 7.08 8.00 -5.76 -5.76 2.4kbps 7.76 8.84 -6.40 -6.64 H 6.44 6.88 -5.80 -5.88 L 6.48 6.88 -5.84 -5.88 2.4kbps 6.44 6.88 -5.80 -5.88 H 6.64 7.28 -5.92 -6.04 L 6.24 6.60 -5.52 -5.52 2.4kbps 6.72 7.16 -5.92 -5.96 H 6.84 7.60 -5.76 -5.76 L 6.88 7.60 -5.76 -5.76 2.4kbps 6.92 7.56 -5.72 -5.76 H 7.28 8.16 -5.80 -5.92 L 6.44 6.84 -5.64 -6.84 2.4kbps 7.08 7.76 -5.80 -5.80 3k // 1000pF 0.047 0.33 Open 3k // 1000pF 1 1 Open 3k // 1000pF VCC = 4.5V VCC = 5.5V VCC = 4.5V VCC = 5.5V The resulting new maximum voltages at V+ and V- are listed in Table 4. Table 4. 4.2 New Measured Withstanding Voltages V+, V- to Ground 13V V+ to V- 20V Transmitters The transmitters are proprietary, low dropout, inverting drivers that translate TTL/CMOS inputs to EIA/TIA-232 output levels. The transmitters are coupled with the on-chip 5.5V supplies to deliver true RS-232 levels over a wide range of single supply system voltages. Transmitter outputs disable and assume a high impedance state when the device enters the powerdown mode (see Table 5 on page 15). The outputs can be driven to 12V when disabled. All devices ensure a 1Mbps data rate for full load conditions (3k and 250pF), VCC 3.0V, with one transmitter operating at full speed. Under more typical conditions of VCC 3.3V, RL = 3k, and CL = 250pF, one transmitter easily operates at 1.4Mbps. Transmitter skew is extremely low on these devices, and is specified at the receiver input trip points (1.4V), rather than the arbitrary 0V crossing point typical of other RS-232 families. Transmitter inputs float if they remain unconnected and can increase ICC. Connect unused inputs to GND for best performance. FN4900 Rev.13.00 May.2.19 Page 13 of 28 ICL3225E, ICL3227E, ICL3245E 4.3 4. Application Information Receivers All the ICL32xxE devices contain standard inverting receivers, but only the ICL3245E receivers can tri-state using the FORCEOFF control line. The ICL3245E includes a noninverting (monitor) receiver (denoted by the ROUTB label) that is always active regardless of the state of any control lines. Both receiver types convert RS-232 signals to CMOS output levels and accept inputs up to 25V while presenting the required 3k to 7k input impedance (see Figure 10) even if the power is off (VCC = 0V). The receivers' Schmitt trigger input stage uses hysteresis to increase noise immunity and decrease errors due to slow input signal transitions. VCC RXOUT RXIN -25V VRIN +25V 5k GND VROUT VCC GND Figure 10. Inverting Receiver Connections The ICL3245E inverting receivers disable during forced (manual) powerdown, but not during automatic powerdown (see Table 5). Conversely, the monitor receiver remains active even during manual powerdown, which makes it extremely useful for Ring Indicator monitoring. Standard receivers driving powered down peripherals must be disabled to prevent current flow through the peripheral's protection diodes (see Figures 11 and 12). When powered down, they cannot be used for wake-up functions, but the corresponding monitor receiver can be dedicated to this task as shown in Figure 12. VCC VCC Transition Detector VCC Current Flow VCC To Wake-Up Logic VCC VOUT = VCC R2OUTB Rx RX Powered Down UART Tx GND SHDN = GND ICL3245E Old RS-232 Chip Powered Down UART VOUT = HI-Z R2OUT TX R2IN T1IN T1OUT FORCEOFF = GND Figure 11. Power Drain Through Powered Down Peripheral FN4900 Rev.13.00 May.2.19 Figure 12. Disabled Receivers Prevent Power Drain Page 14 of 28 ICL3225E, ICL3227E, ICL3245E 4.4 4. Application Information Powerdown Functionality The 3V ICL32xxE devices require a nominal supply current of 0.3mA during normal operation (not in powerdown mode). This current is considerably less than the 5mA to 11mA current required of 5V RS-232 devices. The already low current requirement drops significantly when the device enters powerdown mode. In powerdown, supply current drops to 1A, because the on-chip charge pump turns off (V+ collapses to VCC, V- collapses to GND), and the transmitter outputs tri-state. Inverting receiver outputs may or may not disable in powerdown; see Table 5 for details. This micro-power mode makes these devices ideal for battery powered and portable applications. Table 5. RCVR or XMTR EDGE Within 30 Sec? Powerdown Logic Truth Table FORCEOFF FORCEON Input Input Transmitter Outputs Receiver Outputs ROUTB Outputs (Note 7) RS-232 Level Present at Receiver Input? INVALID Output Mode of Operation ICL3225E, ICL3227E No H H Active Active N.A. No L No H H Active Active N.A. Yes H Yes H L Active Active N.A. No L Yes H L Active Active N.A. Yes H No H L High-Z Active N.A. No L No H L High-Z Active N.A. Yes H X L X High-Z Active N.A. No L X L X High-Z Active N.A. Yes H Normal Operation (Enhanced Auto Powerdown Disabled) Normal Operation (Enhanced Auto Powerdown Enabled) Powerdown Due to Enhanced Auto Powerdown Logic Manual Powerdown ICL322XE - INVALID Driving FORCEON and FORCEOFF (Emulates Automatic Powerdown) X Note 8 Note 8 Active Active N.A. Yes H Normal Operation X Note 8 Note 8 High-Z Active N.A. No L Forced Auto Powerdown No H H Active Active Active No L No H H Active Active Active Yes H Normal Operation (Enhanced Auto Powerdown Disabled) Yes H L Active Active Active No L Yes H L Active Active Active Yes H No H L High-Z Active Active No L No H L High-Z Active Active Yes H X L X High-Z High-Z Active No L X L X High-Z High-Z Active Yes H ICL3245E Normal Operation (Enhanced Auto Powerdown Enabled) Powerdown Due to Enhanced Auto Powerdown Logic Manual Powerdown ICL3245E - INVALID Driving FORCEON and FORCEOFF (Emulates Automatic Powerdown) X Note 8 Note 8 Active Active Active Yes H Normal Operation X Note 8 Note 8 High-Z High-Z Active No L Forced Auto Powerdown Notes: 7. Applies only to the ICL3245E. 8. Input is connected to INVALID Output. FN4900 Rev.13.00 May.2.19 Page 15 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information 4.4.1 Software Controlled (Manual) Powerdown The ICL32xxE devices allow you to force the IC into the low power, standby state, and use a two pin approach where the FORCEON and FORCEOFF inputs determine the IC's mode. For always enabled operation, FORCEON and FORCEOFF are both strapped high. Under logic or software control, only the FORCEOFF input needs to be driven to switch between active and power-down modes. The FORCEON state is not critical because FORCEOFF overrides FORCEON. However, if strictly manual control over power-down is needed, you must strap FORCEON high to disable the automatic powerdown circuitry. The ICL3245E inverting (standard) receiver outputs also disable when the device is in powerdown, and eliminate the possible current path through a shutdown peripheral's input protection diode (see Figures 11 and 12). Connecting FORCEOFF and FORCEON together disables the enhanced automatic powerdown feature, which enables them to function as a manual SHUTDOWN input (see Figure 13). With any of the above control schemes, the time required to exit powerdown and resume transmission is only 100s. FORCEOFF Power Management Logic FORCEON INVALID ICL32xxE I/O UART CPU Figure 13. Connections for Manual Powerdown When No Valid Receiver Signals are Present When using both manual and enhanced automatic powerdown (FORCEON = 0), the ICL32xxE devices do not power up from manual powerdown until both FORCEOFF and FORCEON are driven high, or until a transition occurs on a receiver or transmitter input. Figure 14 shows a circuit for ensuring that the ICL32xxE powers up as soon as FORCEOFF switches high. The rising edge of the master powerdown signal forces the device to power up, and the ICL32xxE returns to enhanced automatic powerdown mode an RC time constant after this rising edge. The time constant is not critical, because the ICL32xxE remains powered up for 30 seconds after the FORCEON falling edge, even if there are no signal transitions. The delay gives slow-to-wake systems (such as a mouse) plenty of time to start transmitting, and as long as it starts transmitting within 30 seconds both systems remain enabled. Power Management Unit Master Powerdown Line 0.1F FORCEOFF 1M FORCEON ICL32xxE Figure 14. Circuit to Ensure Immediate Power Up When Exiting Forced Powerdown 4.4.2 INVALID Output Table 5 on page 15 on the INVALID output always indicates whether 30s have elapsed with invalid RS-232 signals (see Figures 15 and 17) persisting on all of the receiver inputs, and provides you a way to determine when FN4900 Rev.13.00 May.2.19 Page 16 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information the interface block should power down. Invalid receiver levels occur whenever the driving peripheral's outputs are shut off (powered down) or when the RS-232 interface cable is disconnected. If an interface cable is disconnected and all the receiver inputs are floating (but pulled to GND by the internal receiver pull down resistors), the INVALID logic detects the invalid levels and drives the output low. The power management logic then uses this indicator to power down the interface block. Reconnecting the cable restores valid levels at the receiver inputs, INVALID switches high, and the power management logic wakes up the interface block. INVALID can also be used to indicate the DTR or RING INDICATOR signal, as long as the other receiver inputs are floating, or driven to GND (as in the case of a powered down driver). Valid RS-232 Level - INVALID = 1 2.7V Indeterminate 0.3V Invalid Level - INVALID = 0 -0.3V Indeterminate -2.7V Valid RS-232 Level - INVALID = 1 Figure 15. Definition of Valid RS-232 Receiver Levels 4.4.3 Enhanced Automatic Powerdown Even greater power savings are available by using the ICL32xxE's enhanced automatic powerdown function. When the enhanced powerdown logic determines that no transitions have occurred on any of the transmitter or receiver inputs for 30 seconds, the charge pump and transmitters powerdown, and reduces supply current to 1A. The ICL32xxE devices automatically power back up whenever they detect a transition on one of these inputs. The automatic powerdown feature provides additional system power savings without changes to the existing operating system. Enhanced automatic powerdown operates when the FORCEON input is low and the FORCEOFF input is high. Tying FORCEON high disables automatic powerdown, but manual powerdown is always available using the overriding FORCEOFF input. Table 5 on page 15 summarizes the enhanced automatic powerdown functionality. Figure 16 shows the enhanced powerdown control logic. Note: When the ICL32xxE enters powerdown (manually or automatically), the 30 second timer remains timed out (set), keeping the ICL32xxE powered down until FORCEON transitions high, or until a transition occurs on a receiver or transmitter input. FORCEOFF T_IN Edge Detect S R_IN 30s Timer Edge Detect AUTOSHDN R FORCEON Figure 16. Enhanced Automatic Powerdown Logic The INVALID output signal switches low to indicate that invalid levels have persisted on all of the receiver inputs for more than 30s (see Figure 17), but this has no direct effect on the state of the ICL32xxE (see the next sections for methods of using INVALID to power down the device). INVALID switches high 1s after detecting a valid RS-232 level on a receiver input. INVALID operates in all modes (forced or automatic powerdown, or forced on), so it is also useful for systems employing manual powerdown circuitry. FN4900 Rev.13.00 May.2.19 Page 17 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information FORCEON INVALID FORCEOFF ICL32xxE I/O UART CPU Figure 17. Connections for Automatic Powerdown When No Valid Receiver Signals are Present The time to recover from automatic powerdown mode is typically 100s. 4.4.4 Emulating Standard Automatic Powerdown If enhanced automatic powerdown is not desired, you can implement the standard automatic powerdown feature (mimics the function on the ICL3221E/ICL3223E/ICL3243E) by connecting the INVALID output to the FORCEON and FORCEOFF inputs, as shown in Figure 18. After 30s of invalid receiver levels, INVALID switches low and drives the ICL32xxE into a forced powerdown condition. INVALID switches high as soon as a receiver input senses a valid RS-232 level, forcing the ICL32xxE to power on. See "ICL322XE - INVALID Driving FORCEON and FORCEOFF (Emulates Automatic Powerdown)" on page 15 for an operational summary. This operational mode is perfect for handheld devices that communicate with another computer through a detachable cable. Detaching the cable allows the internal receiver pull-down resistors to pull the inputs to GND (an invalid RS-232 level), causing the 30s timer to time out and drive the IC into powerdown. Reconnecting the cable restores valid levels and causes the IC to power back up. Receiver Inputs Invalid } Region Transmitter Inputs Transmitter Outputs tINVH INVALID Output tINVL tAUTOPWDN tAUTOPWDN tWU tWU READY Output V+ VCC 0 V- Figure 18. Enhanced Automatic Powerdown, INVALID and READY Timing Diagrams FN4900 Rev.13.00 May.2.19 Page 18 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information 4.4.5 Hybrid Automatic Powerdown Options For devices that communicate only through a detachable cable, you can connect INVALID to FORCEOFF (with FORCEON = 0). While the cable is attached, INVALID and FORCEOFF remain high, so the enhanced automatic powerdown logic powers down the RS-232 device whenever there is 30 seconds of inactivity on the receiver and transmitter inputs. Detaching the cable allows the receiver inputs to drop to an invalid level (GND), so INVALID switches low and forces the RS-232 device to power down. The ICL32xxE remains powered down until the cable is reconnected (INVALID = FORCEOFF = 1), and a transition occurs on a receiver or transmitter input (see Figure 16 on page 17). For immediate power up when the cable is reattached, connect FORCEON to FORCEOFF through a network similar to that shown in Figure 14 on page 16. 4.5 READY Output (ICL3225E and ICL3227E Only) The READY output indicates that the ICL322xE is ready to transmit. READY switches low whenever the device enters powerdown, and switches back high during power-up when V- reaches -4V or lower. 4.6 Capacitor Selection The charge pumps require 0.1F capacitors for 3.3V operation. For other supply voltages see Table 6 for capacitor values. Do not use values smaller than those listed in Table 6. Increasing the capacitor values (by a factor of 2) reduces ripple on the transmitter outputs and slightly reduces power consumption. C2, C3, and C4 can be increased without increasing C1's value, however, do not increase C1 without also increasing C2, C3, and C4 to maintain the proper ratios (C1 to the other capacitors). When using minimum required capacitor values, make sure that capacitor values do not degrade excessively with temperature. If in doubt, use capacitors with a larger nominal value. The capacitor's Equivalent Series Resistance (ESR) usually rises at low temperatures and it influences the amount of ripple on V+ and V-. Table 6. 4.7 Required Capacitor Values VCC (V) C1 (F) C2, C3, C4 (F) 3.0 to 3.6 0.1 0.1 4.5 to 5.5 0.047 0.33 3.0 to 5.5 0.1 0.47 Power Supply Decoupling In most circumstances a 0.1F bypass capacitor is adequate. In applications that are particularly sensitive to power supply noise, decouple VCC to ground with a capacitor of the same value as the charge-pump capacitor C1. Connect the bypass capacitor as close as possible to the IC. 4.8 Operation Down to 2.7V The ICL32xxE transmitter outputs meet RS-562 levels (3.7V), at full data rate, with VCC as low as 2.7V. RS-562 levels typically ensure interoperability with RS-232 devices. 4.9 Transmitter Outputs when Exiting Powerdown Figure 19 on page 20 shows the response of two transmitter outputs when exiting powerdown mode. As they activate, the two transmitter outputs properly go to opposite RS-232 levels, with no glitching, ringing, or undesirable transients. Each transmitter is loaded with 3k in parallel with 2500pF. Note: The transmitters enable only when the magnitude of the supplies exceed approximately 3V. FN4900 Rev.13.00 May.2.19 Page 19 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information 5V/Div FORCEOFF T1 VCC = +3.3V C1 - C4 = 0.1F 2V/Div T2 5V/Div READY Time (20s/Div) Figure 19. Transmitter Outputs When Exiting Powerdown 4.10 Mouse Driveability The ICL3245E is specifically designed to power a serial mouse while operating from low voltage supplies. Figure 20 shows the transmitter output voltages under increasing load current. The on-chip switching regulator ensures the transmitters supply at least 5V during worst case conditions (15mA for paralleled V+ transmitters, 7.3mA for single V- transmitter). 6 Transmitter Output Voltage (V) 5 VOUT+ 4 VCC = 3.0V 3 2 T1 1 VOUT+ 0 T2 -1 ICL3245E -2 VCC -3 VOUT - T3 VOUT - -4 -5 -6 0 1 2 3 4 5 6 7 8 9 10 Load Current per Transmitter (mA) Figure 20. Transmitter Output Voltage vs Load Current (per Transmitter, For Example, Double Current Axis for Total VOUT+ Current) 4.11 High Data Rates The ICL32xxE maintain the RS-232 5V minimum transmitter output voltages even at high data rates. Figure 21 on page 21 shows a transmitter loopback test circuit, and Figure 22 on page 21 shows the loopback test result at 250kbps. For this test, all transmitters were simultaneously driving RS-232 loads in parallel with 1000pF, at 250kbps. Figure 23 on page 21 shows the loopback results for a single transmitter driving 250pF and an RS-232 load at 1Mbps. The static transmitters were also loaded with an RS-232 receiver. FN4900 Rev.13.00 May.2.19 Page 20 of 28 ICL3225E, ICL3227E, ICL3245E 4. Application Information VCC + 0.1F + C1 VCC C1+ V+ + C3 C1+ C2 ICL32xxE V- C2+ C4 + C2TIN TOUT ROUT FORCEON VCC CL RIN 5k FORCEOFF Figure 21. Transmitter Loopback Test Circuit 5V/Div 5V/Div T1IN T1IN T1OUT T1OUT R1OUT R1OUT VCC = +3.3V C1 - C4 = 0.1F VCC = +3.3V C1 - C4 = 0.1F 0.5s/Div 2s/Div Figure 22. Loopback Test at 250kbps (CL = 1000pF) 4.12 Figure 23. Loopback Test at 1Mbps (CL = 250pF) Interconnection with 3V and 5V Logic The ICL32xxE directly interfaces with 5V CMOS and TTL logic families. The AC, HC, and CD4000 outputs can drive the ICL32xxE inputs with the ICL32xxE at 3.3V and the logic supply at 5V, but ICL32xxE outputs do not reach the minimum VIH for these logic families. See Table 7 for more information. Table 7. Logic Family Compatibility with Various Supply Voltages System Power-Supply Voltage (V) VCC Supply Voltage (V) 3.3 3.3 5 5 5 3.3 FN4900 Rev.13.00 May.2.19 Compatibility Compatible with all CMOS families. Compatible with all TTL and CMOS logic families. Compatible with ACT and HCT CMOS, and with TTL. ICL32xxE outputs are incompatible with AC, HC, and CD4000 CMOS inputs. Page 21 of 28 ICL3225E, ICL3227E, ICL3245E 5. 5. 15kV ESD Protection 15kV ESD Protection All pins on the ICL32xxE devices include ESD protection structures, but the ICL32xxE family incorporates advanced structures that allow the RS-232 pins (transmitter outputs and receiver inputs) to survive ESD events up to 15kV. The RS-232 pins are particularly vulnerable to ESD damage because they typically connect to an exposed port on the exterior of the finished product. Touching the port pins, or connecting a cable, can cause an ESD event that might destroy unprotected ICs. The ESD structures protect the device whether or not it is powered up, protect without allowing any latchup mechanism to activate, and do not interfere with RS-232 signals as large as 25V. 5.1 Human Body Model (HBM) Testing The Human Body Model (HBM) test method emulates the ESD event delivered to an IC during human handling. The tester delivers the charge through a 1.5k current limiting resistor, so the test is less severe than the IEC61000 test, which uses a 330 limiting resistor. The HBM method determines an IC's ability to withstand the ESD transients typically present during handling and manufacturing. Due to the random nature of these events, each pin is tested with respect to all other pins. The RS-232 pins on "E" family devices can withstand HBM ESD events to 15kV. 5.2 IEC61000-4-2 Testing The IEC61000 test method applies to finished equipment, rather than to an individual IC. Therefore, the pins most likely to suffer an ESD event are those that are exposed to the outside world (the RS-232 pins in this case), and the IC is tested in its typical application configuration (power applied) rather than testing each pin-to-pin combination. The lower current limiting resistor coupled with the larger charge storage capacitor yields a test that is much more severe than the HBM test. The extra ESD protection built into this device's RS-232 pins allows the design of equipment meeting Level 4 criteria without the need for additional board level protection on the RS-232 port. 5.3 Air-Gap Discharge Test Method For the air-gap discharge test method, a charged probe tip moves toward the IC pin until the voltage arcs to it. The current waveform delivered to the IC pin depends on factors such as approach speed, humidity, and temperature, so it is difficult to obtain repeatable results. The "E" device RS-232 pins withstand 15kV air-gap discharges. 5.4 Contact Discharge Test Method During the contact discharge test, the probe contacts the tested pin before the probe tip is energized, and eliminates the variables associated with the air-gap discharge. The result is a more repeatable and predictable test, but equipment limits prevent testing devices at voltages higher than 8kV. All "E" family devices survive 8kV contact discharges on the RS-232 pins. FN4900 Rev.13.00 May.2.19 Page 22 of 28 ICL3225E, ICL3227E, ICL3245E 6. 6. Die Characteristics Die Characteristics Substrate Potential (Powered Up) GND Transistor Count ISL3225E: 937 ISL3227E: 825 ISL3245E: 1109 Process Si Gate CMOS FN4900 Rev.13.00 May.2.19 Page 23 of 28 ICL3225E, ICL3227E, ICL3245E 7. 7. Revision History Revision History Rev. Date 13 May.2.19 Updated to latest formatting. Updated Ordering information table by adding active tape and reel information, updated notes, and removed retired parts Added "Charge Pump Abs Max Ratings" on page 12. Removed About Intersil section. Removed PDIP, TSSOP, and SOIC information throughout document. Updated disclaimer. 12 Dec.12.15 Updated entire datasheet applying Intersil's new standards. Updated Ordering information table on page 2. -Updated Tape and Reel note. -Updated Note 2. -Added MSL note. -Removed all non-compliant products. In the "Electrical Specifications" table under "ESD Performance" on page 9, Updated All Other pins section by changing typical value for the ICL3245E from "3" to "2" and adding ICL3225E and ICL3227E information. 11 Dec.3.15 Updated Ordering Information Table on page 2: Added replacement part numbers for ICL3245ECBZ and ICL3245ECVZ. 10 Aug.31.15 Ordering Information Table on page 2. Added Revision History. Added About Intersil Verbiage. Updated POD M28.3 to latest revision changes: Added land pattern. FN4900 Rev.13.00 May.2.19 Description Page 24 of 28 ICL3225E, ICL3227E, ICL3245E 8. 8. Package Outline Drawings Package Outline Drawings For the most recent package outline drawing, see M16.209. M16.209 (JEDEC MO-150-AC ISSUE B) 16 Lead Shrink Small Outline Plastic Package (SSOP INCHES N INDEX AREA H 0.25(0.010) M GAUGE PLANE -B1 2 3 0.25 0.010 SEATING PLANE -A- B M E A D e A2 A1 B C 0.10(0.004) C A M SYMBOL MIN MAX MIN MAX NOTES A - 0.078 - 2.00 - A1 0.002 - 0.05 - - A2 0.065 0.072 1.65 1.85 - B 0.009 0.014 0.22 0.38 9 C 0.004 0.009 0.09 0.25 - D 0.233 0.255 5.90 6.50 3 E 0.197 0.220 5.00 5.60 4 e -C- 0.25(0.010) M L B S MILLIMETERS 0.026 BSC H 0.292 L 0.022 N a 0.65 BSC 0.322 7.40 0.037 0.55 16 0 - 8.20 - 0.95 6 16 8 0 7 8 Rev. 3 6/05 Notes: 1. Symbols are defined in the "MO Series Symbol List" in Section 2.2 of Publication Number 95. 2. Dimensioning and tolerancing per ANSI Y14.5M-1982. 3. Dimension "D" does not include mold flash, protrusions or gate burrs. Mold flash, protrusion and gate burrs shall not exceed 0.20mm (0.0078 inch) per side. 4. Dimension "E" does not include interlead flash or protrusions. Interlead flash and protrusions shall not exceed 0.20mm (0.0078 inch) per side. 5. The chamfer on the body is optional. If it is not present, a visual index feature must be located within the crosshatched area. 6. "L" is the length of terminal for soldering to a substrate. 7. "N" is the number of terminal positions. 8. Terminal numbers are shown for reference only. 9. Dimension "B" does not include dambar protrusion. Allowable dambar protrusion shall be 0.13mm (0.005 inch) total in excess of "B" dimension at maximum material condition. 10. Controlling dimension: MILLIMETER. Converted inch dimensions are not necessarily exact. FN4900 Rev.13.00 May.2.19 Page 25 of 28 ICL3225E, ICL3227E, ICL3245E 8. Package Outline Drawings For the most recent package outline drawing, see M20.209. M20.209 (JEDEC MO-150-AE ISSUE B) 20 Lead Shrink Small Outline Plastic Package (SSOP) N INDEX AREA H 0.25(0.010) M E GAUGE PLANE -B1 2 3 0.25 0.010 SEATING PLANE -A- INCHES B M A D -C- e A1 B 0.25(0.010) M L C 0.10(0.004) C A M SYMBOL MIN MAX MIN MAX A 0.068 0.078 1.73 1.99 A1 0.002 0.008' 0.05 0.21 A2 0.066 0.070' 1.68 1.78 B S NOTES B 0.010' 0.015 0.25 0.38 C 0.004 0.008 0.09 0.20' D 0.278 0.289 7.07 7.33 3 E 0.205 0.212 5.20' 5.38 4 e A2 MILLIMETERS 0.026 BSC H 0.301 L 0.025 N a 0.65 BSC 0.311 7.65 0.037 0.63 20 0 deg. 9 7.90' 0.95 6 20 8 deg. 0 deg. 7 8 deg. Rev. 3 11/02 Notes: 1. Symbols are defined in the "MO Series Symbol List" in Section 2.2 of Publication Number 95. 2. Dimensioning and tolerancing per ANSI Y14.5M-1982. 3. Dimension "D" does not include mold flash, protrusions or gate burrs. Mold flash, protrusion and gate burrs shall not exceed 0.20mm (0.0078 inch) per side. 4. Dimension "E" does not include interlead flash or protrusions. Interlead flash and protrusions shall not exceed 0.20mm (0.0078 inch) per side. 5. The chamfer on the body is optional. If it is not present, a visual index feature must be located within the crosshatched area. 6. "L" is the length of terminal for soldering to a substrate. 7. "N" is the number of terminal positions. 8. Terminal numbers are shown for reference only. 9. Dimension "B" does not include dambar protrusion. Allowable dambar protrusion shall be 0.13mm (0.005 inch) total in excess of "B" dimension at maximum material condition. 10. Controlling dimension: MILLIMETER. Converted inch dimensions are not necessarily exact. FN4900 Rev.13.00 May.2.19 Page 26 of 28 ICL3225E, ICL3227E, ICL3245E 8. Package Outline Drawings For the most recent package outline drawing, see M28.209. M28.209 (JEDEC MO-150-AH ISSUE B) 28 Lead Shrink Small Outline Plastic Package (SSOP) N INDEX AREA H 0.25(0.010) M 2 SYMBOL 3 0.25 0.010 SEATING PLANE -A- INCHES GAUGE PLANE -B1 B M E A D -C- e C 0.10(0.004) C A M B S Notes: 1. Symbols are defined in the "MO Series Symbol List" in Section 2.2 of Publication Number 95. MAX MIN MAX NOTES A - 0.078 - 2.00 - A1 0.002 - 0.05 - - A2 0.065 0.072 1.65 1.85 - B 0.009 0.014 0.22 0.38 9 C 0.004 0.009 0.09 0.25 - D 0.390 0.413 9.90 10.50 3 E 0.197 0.220 5.00 5.60 4 e A2 A1 B 0.25(0.010) M L MILLIMETERS MIN 0.026 BSC 0.65 BSC - H 0.292 0.322 7.40 8.20 - L 0.022 0.037 0.55 0.95 6 8 0 N 28 0 28 7 8 Rev. 2 6/05 2. Dimensioning and tolerancing per ANSI Y14.5M-1982. 3. Dimension "D" does not include mold flash, protrusions or gate burrs. Mold flash, protrusion and gate burrs shall not exceed 0.20mm (0.0078 inch) per side. 4. Dimension "E" does not include interlead flash or protrusions. Interlead flash and protrusions shall not exceed 0.20mm (0.0078 inch) per side. 5. The chamfer on the body is optional. If it is not present, a visual index feature must be located within the crosshatched area. 6. "L" is the length of terminal for soldering to a substrate. 7. "N" is the number of terminal positions. 8. Terminal numbers are shown for reference only. 9. Dimension "B" does not include dambar protrusion. Allowable dambar protrusion shall be 0.13mm (0.005 inch) total in excess of "B" dimension at maximum material condition. 10. Controlling dimension: MILLIMETER. Converted inch dimensions are not necessarily exact. FN4900 Rev.13.00 May.2.19 Page 27 of 28 1RWLFH 'HVFULSWLRQVRIFLUFXLWVVRIWZDUHDQGRWKHUUHODWHGLQIRUPDWLRQLQWKLVGRFXPHQWDUHSURYLGHGRQO\WRLOOXVWUDWHWKHRSHUDWLRQRIVHPLFRQGXFWRUSURGXFWV DQGDSSOLFDWLRQH[DPSOHV<RXDUHIXOO\UHVSRQVLEOHIRUWKHLQFRUSRUDWLRQRUDQ\RWKHUXVHRIWKHFLUFXLWVVRIWZDUHDQGLQIRUPDWLRQLQWKHGHVLJQRI\RXU SURGXFWRUV\VWHP5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\ORVVHVDQGGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPWKHXVHRI WKHVHFLUFXLWVVRIWZDUHRULQIRUPDWLRQ 5HQHVDV(OHFWURQLFVKHUHE\H[SUHVVO\GLVFODLPVDQ\ZDUUDQWLHVDJDLQVWDQGOLDELOLW\IRULQIULQJHPHQWRUDQ\RWKHUFODLPVLQYROYLQJSDWHQWVFRS\ULJKWVRU RWKHULQWHOOHFWXDOSURSHUW\ULJKWVRIWKLUGSDUWLHVE\RUDULVLQJIURPWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRUWHFKQLFDOLQIRUPDWLRQGHVFULEHGLQWKLV GRFXPHQWLQFOXGLQJEXWQRWOLPLWHGWRWKHSURGXFWGDWDGUDZLQJVFKDUWVSURJUDPVDOJRULWKPVDQGDSSOLFDWLRQH[DPSOHV 1ROLFHQVHH[SUHVVLPSOLHGRURWKHUZLVHLVJUDQWHGKHUHE\XQGHUDQ\SDWHQWVFRS\ULJKWVRURWKHULQWHOOHFWXDOSURSHUW\ULJKWVRI5HQHVDV(OHFWURQLFVRU RWKHUV <RXVKDOOQRWDOWHUPRGLI\FRS\RUUHYHUVHHQJLQHHUDQ\5HQHVDV(OHFWURQLFVSURGXFWZKHWKHULQZKROHRULQSDUW5HQHVDV(OHFWURQLFVGLVFODLPVDQ\ DQGDOOOLDELOLW\IRUDQ\ORVVHVRUGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPVXFKDOWHUDWLRQPRGLILFDWLRQFRS\LQJRUUHYHUVHHQJLQHHULQJ 5HQHVDV(OHFWURQLFVSURGXFWVDUHFODVVLILHGDFFRUGLQJWRWKHIROORZLQJWZRTXDOLW\JUDGHV6WDQGDUGDQG+LJK4XDOLW\7KHLQWHQGHGDSSOLFDWLRQVIRU HDFK5HQHVDV(OHFWURQLFVSURGXFWGHSHQGVRQWKHSURGXFW VTXDOLW\JUDGHDVLQGLFDWHGEHORZ 6WDQGDUG &RPSXWHUVRIILFHHTXLSPHQWFRPPXQLFDWLRQVHTXLSPHQWWHVWDQGPHDVXUHPHQWHTXLSPHQWDXGLRDQGYLVXDOHTXLSPHQWKRPH HOHFWURQLFDSSOLDQFHVPDFKLQHWRROVSHUVRQDOHOHFWURQLFHTXLSPHQWLQGXVWULDOURERWVHWF +LJK4XDOLW\ 7UDQVSRUWDWLRQHTXLSPHQWDXWRPRELOHVWUDLQVVKLSVHWF WUDIILFFRQWUROWUDIILFOLJKWV ODUJHVFDOHFRPPXQLFDWLRQHTXLSPHQWNH\ ILQDQFLDOWHUPLQDOV\VWHPVVDIHW\FRQWUROHTXLSPHQWHWF 8QOHVVH[SUHVVO\GHVLJQDWHGDVDKLJKUHOLDELOLW\SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV (OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWVDUHQRWLQWHQGHGRUDXWKRUL]HGIRUXVHLQSURGXFWVRUV\VWHPVWKDWPD\SRVHDGLUHFWWKUHDWWR KXPDQOLIHRUERGLO\LQMXU\DUWLILFLDOOLIHVXSSRUWGHYLFHVRUV\VWHPVVXUJLFDOLPSODQWDWLRQVHWF RUPD\FDXVHVHULRXVSURSHUW\GDPDJHVSDFHV\VWHP XQGHUVHDUHSHDWHUVQXFOHDUSRZHUFRQWUROV\VWHPVDLUFUDIWFRQWUROV\VWHPVNH\SODQWV\VWHPVPLOLWDU\HTXLSPHQWHWF 5HQHVDV(OHFWURQLFVGLVFODLPV DQ\DQGDOOOLDELOLW\IRUDQ\GDPDJHVRUORVVHVLQFXUUHGE\\RXRUDQ\WKLUGSDUWLHVDULVLQJIURPWKHXVHRIDQ\5HQHVDV(OHFWURQLFVSURGXFWWKDWLV LQFRQVLVWHQWZLWKDQ\5HQHVDV(OHFWURQLFVGDWDVKHHWXVHU VPDQXDORURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW :KHQXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVUHIHUWRWKHODWHVWSURGXFWLQIRUPDWLRQGDWDVKHHWVXVHU VPDQXDOVDSSOLFDWLRQQRWHV*HQHUDO1RWHVIRU +DQGOLQJDQG8VLQJ6HPLFRQGXFWRU'HYLFHVLQWKHUHOLDELOLW\KDQGERRNHWF DQGHQVXUHWKDWXVDJHFRQGLWLRQVDUHZLWKLQWKHUDQJHVVSHFLILHGE\ 5HQHVDV(OHFWURQLFVZLWKUHVSHFWWRPD[LPXPUDWLQJVRSHUDWLQJSRZHUVXSSO\YROWDJHUDQJHKHDWGLVVLSDWLRQFKDUDFWHULVWLFVLQVWDOODWLRQHWF5HQHVDV (OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\PDOIXQFWLRQVIDLOXUHRUDFFLGHQWDULVLQJRXWRIWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRXWVLGHRIVXFK VSHFLILHGUDQJHV $OWKRXJK5HQHVDV(OHFWURQLFVHQGHDYRUVWRLPSURYHWKHTXDOLW\DQGUHOLDELOLW\RI5HQHVDV(OHFWURQLFVSURGXFWVVHPLFRQGXFWRUSURGXFWVKDYHVSHFLILF FKDUDFWHULVWLFVVXFKDVWKHRFFXUUHQFHRIIDLOXUHDWDFHUWDLQUDWHDQGPDOIXQFWLRQVXQGHUFHUWDLQXVHFRQGLWLRQV8QOHVVGHVLJQDWHGDVDKLJKUHOLDELOLW\ SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWV DUHQRWVXEMHFWWRUDGLDWLRQUHVLVWDQFHGHVLJQ<RXDUHUHVSRQVLEOHIRULPSOHPHQWLQJVDIHW\PHDVXUHVWRJXDUGDJDLQVWWKHSRVVLELOLW\RIERGLO\LQMXU\ LQMXU\RUGDPDJHFDXVHGE\ILUHDQGRUGDQJHUWRWKHSXEOLFLQWKHHYHQWRIDIDLOXUHRUPDOIXQFWLRQRI5HQHVDV(OHFWURQLFVSURGXFWVVXFKDVVDIHW\ GHVLJQIRUKDUGZDUHDQGVRIWZDUHLQFOXGLQJEXWQRWOLPLWHGWRUHGXQGDQF\ILUHFRQWURODQGPDOIXQFWLRQSUHYHQWLRQDSSURSULDWHWUHDWPHQWIRUDJLQJ GHJUDGDWLRQRUDQ\RWKHUDSSURSULDWHPHDVXUHV%HFDXVHWKHHYDOXDWLRQRIPLFURFRPSXWHUVRIWZDUHDORQHLVYHU\GLIILFXOWDQGLPSUDFWLFDO\RXDUH UHVSRQVLEOHIRUHYDOXDWLQJWKHVDIHW\RIWKHILQDOSURGXFWVRUV\VWHPVPDQXIDFWXUHGE\\RX 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHIRUGHWDLOVDVWRHQYLURQPHQWDOPDWWHUVVXFKDVWKHHQYLURQPHQWDOFRPSDWLELOLW\RIHDFK5HQHVDV (OHFWURQLFVSURGXFW<RXDUHUHVSRQVLEOHIRUFDUHIXOO\DQGVXIILFLHQWO\LQYHVWLJDWLQJDSSOLFDEOHODZVDQGUHJXODWLRQVWKDWUHJXODWHWKHLQFOXVLRQRUXVHRI FRQWUROOHGVXEVWDQFHVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH(85R+6'LUHFWLYHDQGXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVLQFRPSOLDQFHZLWKDOOWKHVH DSSOLFDEOHODZVDQGUHJXODWLRQV5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUGDPDJHVRUORVVHVRFFXUULQJDVDUHVXOWRI\RXUQRQFRPSOLDQFH ZLWKDSSOLFDEOHODZVDQGUHJXODWLRQV 5HQHVDV(OHFWURQLFVSURGXFWVDQGWHFKQRORJLHVVKDOOQRWEHXVHGIRURULQFRUSRUDWHGLQWRDQ\SURGXFWVRUV\VWHPVZKRVHPDQXIDFWXUHXVHRUVDOHLV SURKLELWHGXQGHUDQ\DSSOLFDEOHGRPHVWLFRUIRUHLJQODZVRUUHJXODWLRQV<RXVKDOOFRPSO\ZLWKDQ\DSSOLFDEOHH[SRUWFRQWUROODZVDQGUHJXODWLRQV SURPXOJDWHGDQGDGPLQLVWHUHGE\WKHJRYHUQPHQWVRIDQ\FRXQWULHVDVVHUWLQJMXULVGLFWLRQRYHUWKHSDUWLHVRUWUDQVDFWLRQV ,WLVWKHUHVSRQVLELOLW\RIWKHEX\HURUGLVWULEXWRURI5HQHVDV(OHFWURQLFVSURGXFWVRUDQ\RWKHUSDUW\ZKRGLVWULEXWHVGLVSRVHVRIRURWKHUZLVHVHOOVRU WUDQVIHUVWKHSURGXFWWRDWKLUGSDUW\WRQRWLI\VXFKWKLUGSDUW\LQDGYDQFHRIWKHFRQWHQWVDQGFRQGLWLRQVVHWIRUWKLQWKLVGRFXPHQW 7KLVGRFXPHQWVKDOOQRWEHUHSULQWHGUHSURGXFHGRUGXSOLFDWHGLQDQ\IRUPLQZKROHRULQSDUWZLWKRXWSULRUZULWWHQFRQVHQWRI5HQHVDV(OHFWURQLFV 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHLI\RXKDYHDQ\TXHVWLRQVUHJDUGLQJWKHLQIRUPDWLRQFRQWDLQHGLQWKLVGRFXPHQWRU5HQHVDV (OHFWURQLFVSURGXFWV 1RWH 1RWH 5HQHVDV(OHFWURQLFVDVXVHGLQWKLVGRFXPHQWPHDQV5HQHVDV(OHFWURQLFV&RUSRUDWLRQDQGDOVRLQFOXGHVLWVGLUHFWO\RULQGLUHFWO\FRQWUROOHG VXEVLGLDULHV 5HQHVDV(OHFWURQLFVSURGXFWV PHDQVDQ\SURGXFWGHYHORSHGRUPDQXIDFWXUHGE\RUIRU5HQHVDV(OHFWURQLFV 5HY1RYHPEHU &RUSRUDWH+HDGTXDUWHUV &RQWDFW,QIRUPDWLRQ 72<268)25(6,$7R\RVX .RWRNX7RN\R-DSDQ TOYOSU FORESIA, 3-2-24 Toyosu, )RUIXUWKHULQIRUPDWLRQRQDSURGXFWWHFKQRORJ\WKHPRVWXSWRGDWH YHUVLRQRIDGRFXPHQWRU\RXUQHDUHVWVDOHVRIILFHSOHDVHYLVLW For further information on a product, technology, the most up-to-date Koto-ku, Tokyo 135-0061, Japan ZZZUHQHVDVFRP version of a document, or your nearest sales office, please visit: ZZZUHQHVDVFRPFRQWDFW Corporate Headquarters www.renesas.com Contact Information www.renesas.com/contact/ 7UDGHPDUNV Trademarks 5HQHVDVDQGWKH5HQHVDVORJRDUHWUDGHPDUNVRI5HQHVDV(OHFWURQLFV &RUSRUDWLRQ$OOWUDGHPDUNVDQGUHJLVWHUHGWUDGHPDUNVDUHWKHSURSHUW\ Renesas and the Renesas logo are trademarks of Renesas Electronics RIWKHLUUHVSHFWLYHRZQHUV Corporation. All trademarks and registered trademarks are the property of their respective owners. 5HQHVDV(OHFWURQLFV&RUSRUDWLRQ$OOULJKWVUHVHUYHG